Anti ETNK2 pAb (ATL-HPA057167 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA057167-25

• 

Product Description

Protein Description: ethanolamine kinase 2
Gene Name: ETNK2
Alternative Gene Name: EKI2, FLJ10761
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070644: 73%, ENSRNOG00000028368: 76%
Entrez Gene ID: 55224
Uniprot ID: Q9NVF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFHLRRHTPCPQCSWGMEEKAAASASCREPPGPPRAAAVAYFGISVDPDDILPGALRLIQEL
• Gene Sequence: SFHLRRHTPCPQCSWGMEEKAAASASCREPPGPPRAAAVAYFGISVDPDDILPGALRLIQEL
• Gene ID - Mouse: ENSMUSG00000070644
• Gene ID - Rat: ENSRNOG00000028368
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.