Description
Product Description
Protein Description: ethanolamine kinase 2
Gene Name: ETNK2
Alternative Gene Name: EKI2, FLJ10761
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070644: 73%, ENSRNOG00000028368: 76%
Entrez Gene ID: 55224
Uniprot ID: Q9NVF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ETNK2
Alternative Gene Name: EKI2, FLJ10761
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070644: 73%, ENSRNOG00000028368: 76%
Entrez Gene ID: 55224
Uniprot ID: Q9NVF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SFHLRRHTPCPQCSWGMEEKAAASASCREPPGPPRAAAVAYFGISVDPDDILPGALRLIQEL |
Gene Sequence | SFHLRRHTPCPQCSWGMEEKAAASASCREPPGPPRAAAVAYFGISVDPDDILPGALRLIQEL |
Gene ID - Mouse | ENSMUSG00000070644 |
Gene ID - Rat | ENSRNOG00000028368 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ETNK2 pAb (ATL-HPA057167 w/enhanced validation) | |
Datasheet | Anti ETNK2 pAb (ATL-HPA057167 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ETNK2 pAb (ATL-HPA057167 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ETNK2 pAb (ATL-HPA057167 w/enhanced validation) | |
Datasheet | Anti ETNK2 pAb (ATL-HPA057167 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ETNK2 pAb (ATL-HPA057167 w/enhanced validation) |