Description
Product Description
Protein Description: extended synaptotagmin-like protein 1
Gene Name: ESYT1
Alternative Gene Name: FAM62A, KIAA0747, MBC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025366: 81%, ENSRNOG00000060753: 81%
Entrez Gene ID: 23344
Uniprot ID: Q9BSJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ESYT1
Alternative Gene Name: FAM62A, KIAA0747, MBC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025366: 81%, ENSRNOG00000060753: 81%
Entrez Gene ID: 23344
Uniprot ID: Q9BSJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSGPNSRLYMKLVMRILYLDSSEICFPTVPGCPGAWDVDSENPQRGSSVDAPPRPCHTTPDSQFGTEHVLRIHVLEAQDLIAKDRF |
Gene Sequence | SSGPNSRLYMKLVMRILYLDSSEICFPTVPGCPGAWDVDSENPQRGSSVDAPPRPCHTTPDSQFGTEHVLRIHVLEAQDLIAKDRF |
Gene ID - Mouse | ENSMUSG00000025366 |
Gene ID - Rat | ENSRNOG00000060753 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ESYT1 pAb (ATL-HPA076926) | |
Datasheet | Anti ESYT1 pAb (ATL-HPA076926) Datasheet (External Link) |
Vendor Page | Anti ESYT1 pAb (ATL-HPA076926) at Atlas Antibodies |
Documents & Links for Anti ESYT1 pAb (ATL-HPA076926) | |
Datasheet | Anti ESYT1 pAb (ATL-HPA076926) Datasheet (External Link) |
Vendor Page | Anti ESYT1 pAb (ATL-HPA076926) |