Protein Description: estrogen-related receptor gamma
Gene Name: ESRRG
Alternative Gene Name: NR3B3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026610: 100%, ENSRNOG00000002593: 100%
Entrez Gene ID: 2104
Uniprot ID: P62508
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ESRRG
Alternative Gene Name: NR3B3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026610: 100%, ENSRNOG00000002593: 100%
Entrez Gene ID: 2104
Uniprot ID: P62508
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPK |
| Gene Sequence | SGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPK |
| Gene ID - Mouse | ENSMUSG00000026610 |
| Gene ID - Rat | ENSRNOG00000002593 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ESRRG pAb (ATL-HPA044678) | |
| Datasheet | Anti ESRRG pAb (ATL-HPA044678) Datasheet (External Link) |
| Vendor Page | Anti ESRRG pAb (ATL-HPA044678) at Atlas |
| Documents & Links for Anti ESRRG pAb (ATL-HPA044678) | |
| Datasheet | Anti ESRRG pAb (ATL-HPA044678) Datasheet (External Link) |
| Vendor Page | Anti ESRRG pAb (ATL-HPA044678) |