Protein Description: estrogen related receptor alpha
Gene Name: ESRRA
Alternative Gene Name: ERR1, ERRa, ERRalpha, ESRL1, NR3B1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024955: 98%, ENSRNOG00000021139: 98%
Entrez Gene ID: 2101
Uniprot ID: P11474
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ESRRA
Alternative Gene Name: ERR1, ERRa, ERRalpha, ESRL1, NR3B1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024955: 98%, ENSRNOG00000021139: 98%
Entrez Gene ID: 2101
Uniprot ID: P11474
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAGLGELGAAL |
| Documents & Links for Anti ESRRA pAb (ATL-HPA077297) | |
| Datasheet | Anti ESRRA pAb (ATL-HPA077297) Datasheet (External Link) |
| Vendor Page | Anti ESRRA pAb (ATL-HPA077297) at Atlas |
| Documents & Links for Anti ESRRA pAb (ATL-HPA077297) | |
| Datasheet | Anti ESRRA pAb (ATL-HPA077297) Datasheet (External Link) |
| Vendor Page | Anti ESRRA pAb (ATL-HPA077297) |