Anti ESRRA pAb (ATL-HPA077297)

Atlas Antibodies

Catalog No: ATL-HPA077297-25

• 

Product Description

Protein Description: estrogen related receptor alpha
Gene Name: ESRRA
Alternative Gene Name: ERR1, ERRa, ERRalpha, ESRL1, NR3B1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024955: 98%, ENSRNOG00000021139: 98%
Entrez Gene ID: 2101
Uniprot ID: P11474
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAGLGELGAAL
• Gene Sequence: SDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAGLGELGAAL
• Gene ID - Mouse: ENSMUSG00000024955
• Gene ID - Rat: ENSRNOG00000021139
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.