Protein Description: epithelial splicing regulatory protein 1
Gene Name: ESRP1
Alternative Gene Name: FLJ20171, RBM35A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040728: 95%, ENSRNOG00000008184: 95%
Entrez Gene ID: 54845
Uniprot ID: Q6NXG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ESRP1
Alternative Gene Name: FLJ20171, RBM35A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040728: 95%, ENSRNOG00000008184: 95%
Entrez Gene ID: 54845
Uniprot ID: Q6NXG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKIDVESLSSASQLDQALRQFNQSVSNELNIGVGT |
Documents & Links for Anti ESRP1 pAb (ATL-HPA067104 w/enhanced validation) | |
Datasheet | Anti ESRP1 pAb (ATL-HPA067104 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ESRP1 pAb (ATL-HPA067104 w/enhanced validation) at Atlas |
Documents & Links for Anti ESRP1 pAb (ATL-HPA067104 w/enhanced validation) | |
Datasheet | Anti ESRP1 pAb (ATL-HPA067104 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ESRP1 pAb (ATL-HPA067104 w/enhanced validation) |