Protein Description: endoplasmic reticulum to nucleus signaling 2
Gene Name: ERN2
Alternative Gene Name: IRE1b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030866: 65%, ENSRNOG00000018974: 61%
Entrez Gene ID: 10595
Uniprot ID: Q76MJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ERN2
Alternative Gene Name: IRE1b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030866: 65%, ENSRNOG00000018974: 61%
Entrez Gene ID: 10595
Uniprot ID: Q76MJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HHELPPVLHTTMLRVHPTLGSGTAETRPPENTQAPAFFLELLSLSREKLWDSELHPEEKTPDSYLGLGPQD |
| Documents & Links for Anti ERN2 pAb (ATL-HPA076875) | |
| Datasheet | Anti ERN2 pAb (ATL-HPA076875) Datasheet (External Link) |
| Vendor Page | Anti ERN2 pAb (ATL-HPA076875) at Atlas |
| Documents & Links for Anti ERN2 pAb (ATL-HPA076875) | |
| Datasheet | Anti ERN2 pAb (ATL-HPA076875) Datasheet (External Link) |
| Vendor Page | Anti ERN2 pAb (ATL-HPA076875) |