Protein Description: endoplasmic reticulum metallopeptidase 1
Gene Name: ERMP1
Alternative Gene Name: FLJ23309, FXNA, KIAA1815
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046324: 89%, ENSRNOG00000010915: 89%
Entrez Gene ID: 79956
Uniprot ID: Q7Z2K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ERMP1
Alternative Gene Name: FLJ23309, FXNA, KIAA1815
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046324: 89%, ENSRNOG00000010915: 89%
Entrez Gene ID: 79956
Uniprot ID: Q7Z2K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SSNPANPKPKRVFLQHMTRTFHDLEGNAVKRDSGIWINGFDYTGISHITPHIPEINDSIRAHCEENAPLCGFPWYLPVHFLIRKNWYLPAPEVSPRNPPHFRLISKEQTPWDSIKLTFEATGPSHMSFYVRAHKGSTLSQWSLGNGTPV |
| Documents & Links for Anti ERMP1 pAb (ATL-HPA020584) | |
| Datasheet | Anti ERMP1 pAb (ATL-HPA020584) Datasheet (External Link) |
| Vendor Page | Anti ERMP1 pAb (ATL-HPA020584) at Atlas |
| Documents & Links for Anti ERMP1 pAb (ATL-HPA020584) | |
| Datasheet | Anti ERMP1 pAb (ATL-HPA020584) Datasheet (External Link) |
| Vendor Page | Anti ERMP1 pAb (ATL-HPA020584) |