Protein Description: glutamate rich 3
Gene Name: ERICH3
Alternative Gene Name: C1orf173, DKFZp547I048, RP11-653A5.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078161: 83%, ENSRNOG00000009533: 81%
Entrez Gene ID: 127254
Uniprot ID: Q5RHP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ERICH3
Alternative Gene Name: C1orf173, DKFZp547I048, RP11-653A5.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078161: 83%, ENSRNOG00000009533: 81%
Entrez Gene ID: 127254
Uniprot ID: Q5RHP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GLEPLLTKDSRRIHKTSLHSNAAITMIYLGKNVHLSSDNPDFRDEIKVYQQHCGGENLCVYKGKLLEKETFQFISKRHHGFPFSLTFFLNGMQVNRLSSCCE |
| Documents & Links for Anti ERICH3 pAb (ATL-HPA072916) | |
| Datasheet | Anti ERICH3 pAb (ATL-HPA072916) Datasheet (External Link) |
| Vendor Page | Anti ERICH3 pAb (ATL-HPA072916) at Atlas |
| Documents & Links for Anti ERICH3 pAb (ATL-HPA072916) | |
| Datasheet | Anti ERICH3 pAb (ATL-HPA072916) Datasheet (External Link) |
| Vendor Page | Anti ERICH3 pAb (ATL-HPA072916) |