Protein Description: ERCC excision repair 6, chromatin remodeling factor
Gene Name: ERCC6
Alternative Gene Name: ARMD5, CKN2, CSB, RAD26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050373: 25%, ENSRNOG00000053247: 25%
Entrez Gene ID: 2074
Uniprot ID: Q8N328
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ERCC6
Alternative Gene Name: ARMD5, CKN2, CSB, RAD26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050373: 25%, ENSRNOG00000053247: 25%
Entrez Gene ID: 2074
Uniprot ID: Q8N328
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TLSLHEITDLLETDDSIEASAIVIQPPENATAPVSDEESGDEEGGTINNLPGSLLHTAAYLIQDGSDAESDSDDPSYAPKDDSPDEVPSTFTVQQPPPSRRRKMTKILCKWKKADLTVQPVAGRVTAPPNDFFTVMRTPTE |
| Documents & Links for Anti ERCC6 pAb (ATL-HPA071297) | |
| Datasheet | Anti ERCC6 pAb (ATL-HPA071297) Datasheet (External Link) |
| Vendor Page | Anti ERCC6 pAb (ATL-HPA071297) at Atlas |
| Documents & Links for Anti ERCC6 pAb (ATL-HPA071297) | |
| Datasheet | Anti ERCC6 pAb (ATL-HPA071297) Datasheet (External Link) |
| Vendor Page | Anti ERCC6 pAb (ATL-HPA071297) |