Protein Description: v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4
Gene Name: ERBB4
Alternative Gene Name: ALS19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062209: 91%, ENSRNOG00000014248: 79%
Entrez Gene ID: 2066
Uniprot ID: Q15303
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ERBB4
Alternative Gene Name: ALS19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062209: 91%, ENSRNOG00000014248: 79%
Entrez Gene ID: 2066
Uniprot ID: Q15303
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRK |
| Documents & Links for Anti ERBB4 pAb (ATL-HPA012016 w/enhanced validation) | |
| Datasheet | Anti ERBB4 pAb (ATL-HPA012016 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ERBB4 pAb (ATL-HPA012016 w/enhanced validation) at Atlas |
| Documents & Links for Anti ERBB4 pAb (ATL-HPA012016 w/enhanced validation) | |
| Datasheet | Anti ERBB4 pAb (ATL-HPA012016 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ERBB4 pAb (ATL-HPA012016 w/enhanced validation) |