Protein Description: endoplasmic reticulum aminopeptidase 1
Gene Name: ERAP1
Alternative Gene Name: A-LAP, ARTS-1, ERAAP1, KIAA0525, PILS-AP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021583: 87%, ENSRNOG00000009997: 88%
Entrez Gene ID: 51752
Uniprot ID: Q9NZ08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ERAP1
Alternative Gene Name: A-LAP, ARTS-1, ERAAP1, KIAA0525, PILS-AP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021583: 87%, ENSRNOG00000009997: 88%
Entrez Gene ID: 51752
Uniprot ID: Q9NZ08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLS |
Gene Sequence | FQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLS |
Gene ID - Mouse | ENSMUSG00000021583 |
Gene ID - Rat | ENSRNOG00000009997 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ERAP1 pAb (ATL-HPA042317) | |
Datasheet | Anti ERAP1 pAb (ATL-HPA042317) Datasheet (External Link) |
Vendor Page | Anti ERAP1 pAb (ATL-HPA042317) at Atlas |
Documents & Links for Anti ERAP1 pAb (ATL-HPA042317) | |
Datasheet | Anti ERAP1 pAb (ATL-HPA042317) Datasheet (External Link) |
Vendor Page | Anti ERAP1 pAb (ATL-HPA042317) |