Anti EPPK1 pAb (ATL-HPA069333)

Catalog No:
ATL-HPA069333-25
$447.00

Description

Product Description

Protein Description: epiplakin 1
Gene Name: EPPK1
Alternative Gene Name: EPIPL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022565: 37%, ENSRNOG00000023781: 37%
Entrez Gene ID: 83481
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ECPRDETSGLHLLPLPESAPALPTEEQVQRSLQAVPGAKDGTSLWDLLSSCHFTEEQRRGLLEDVQEGRTTVPQLLASVQRWVQETKL
Gene Sequence ECPRDETSGLHLLPLPESAPALPTEEQVQRSLQAVPGAKDGTSLWDLLSSCHFTEEQRRGLLEDVQEGRTTVPQLLASVQRWVQETKL
Gene ID - Mouse ENSMUSG00000022565
Gene ID - Rat ENSRNOG00000023781
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti EPPK1 pAb (ATL-HPA069333)
Datasheet Anti EPPK1 pAb (ATL-HPA069333) Datasheet (External Link)
Vendor Page Anti EPPK1 pAb (ATL-HPA069333) at Atlas Antibodies

Documents & Links for Anti EPPK1 pAb (ATL-HPA069333)
Datasheet Anti EPPK1 pAb (ATL-HPA069333) Datasheet (External Link)
Vendor Page Anti EPPK1 pAb (ATL-HPA069333)

Product Description

Protein Description: epiplakin 1
Gene Name: EPPK1
Alternative Gene Name: EPIPL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022565: 37%, ENSRNOG00000023781: 37%
Entrez Gene ID: 83481
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ECPRDETSGLHLLPLPESAPALPTEEQVQRSLQAVPGAKDGTSLWDLLSSCHFTEEQRRGLLEDVQEGRTTVPQLLASVQRWVQETKL
Gene Sequence ECPRDETSGLHLLPLPESAPALPTEEQVQRSLQAVPGAKDGTSLWDLLSSCHFTEEQRRGLLEDVQEGRTTVPQLLASVQRWVQETKL
Gene ID - Mouse ENSMUSG00000022565
Gene ID - Rat ENSRNOG00000023781
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti EPPK1 pAb (ATL-HPA069333)
Datasheet Anti EPPK1 pAb (ATL-HPA069333) Datasheet (External Link)
Vendor Page Anti EPPK1 pAb (ATL-HPA069333) at Atlas Antibodies

Documents & Links for Anti EPPK1 pAb (ATL-HPA069333)
Datasheet Anti EPPK1 pAb (ATL-HPA069333) Datasheet (External Link)
Vendor Page Anti EPPK1 pAb (ATL-HPA069333)