Protein Description: epiplakin 1
Gene Name: EPPK1
Alternative Gene Name: EPIPL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022565: 36%, ENSRNOG00000023781: 36%
Entrez Gene ID: 83481
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EPPK1
Alternative Gene Name: EPIPL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022565: 36%, ENSRNOG00000023781: 36%
Entrez Gene ID: 83481
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | STGRFKGCSVSLWDLLLSEYVGADKRRELVALCRSGRAAALRQVVSAVTTLVEAAERQPLQATFRGLRKQVSARDLFRAQLISRKTLDEL |
Documents & Links for Anti EPPK1 pAb (ATL-HPA067357) | |
Datasheet | Anti EPPK1 pAb (ATL-HPA067357) Datasheet (External Link) |
Vendor Page | Anti EPPK1 pAb (ATL-HPA067357) at Atlas |
Documents & Links for Anti EPPK1 pAb (ATL-HPA067357) | |
Datasheet | Anti EPPK1 pAb (ATL-HPA067357) Datasheet (External Link) |
Vendor Page | Anti EPPK1 pAb (ATL-HPA067357) |