Protein Description: EPPIN-WFDC6 readthrough
Gene Name: EPPIN-WFDC6
Alternative Gene Name: SPINLW1-WFDC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017733: 69%, ENSRNOG00000028908: 72%
Entrez Gene ID: 100526773
Uniprot ID: O95925
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EPPIN-WFDC6
Alternative Gene Name: SPINLW1-WFDC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017733: 69%, ENSRNOG00000028908: 72%
Entrez Gene ID: 100526773
Uniprot ID: O95925
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQD |
| Documents & Links for Anti EPPIN-WFDC6 pAb (ATL-HPA067335) | |
| Datasheet | Anti EPPIN-WFDC6 pAb (ATL-HPA067335) Datasheet (External Link) |
| Vendor Page | Anti EPPIN-WFDC6 pAb (ATL-HPA067335) at Atlas |
| Documents & Links for Anti EPPIN-WFDC6 pAb (ATL-HPA067335) | |
| Datasheet | Anti EPPIN-WFDC6 pAb (ATL-HPA067335) Datasheet (External Link) |
| Vendor Page | Anti EPPIN-WFDC6 pAb (ATL-HPA067335) |