Description
Product Description
Protein Description: EPPIN-WFDC6 readthrough
Gene Name: EPPIN-WFDC6
Alternative Gene Name: SPINLW1-WFDC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017733: 69%, ENSRNOG00000028908: 72%
Entrez Gene ID: 100526773
Uniprot ID: O95925
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EPPIN-WFDC6
Alternative Gene Name: SPINLW1-WFDC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017733: 69%, ENSRNOG00000028908: 72%
Entrez Gene ID: 100526773
Uniprot ID: O95925
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQD |
Gene Sequence | GPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQD |
Gene ID - Mouse | ENSMUSG00000017733 |
Gene ID - Rat | ENSRNOG00000028908 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti EPPIN-WFDC6 pAb (ATL-HPA067335) | |
Datasheet | Anti EPPIN-WFDC6 pAb (ATL-HPA067335) Datasheet (External Link) |
Vendor Page | Anti EPPIN-WFDC6 pAb (ATL-HPA067335) at Atlas Antibodies |
Documents & Links for Anti EPPIN-WFDC6 pAb (ATL-HPA067335) | |
Datasheet | Anti EPPIN-WFDC6 pAb (ATL-HPA067335) Datasheet (External Link) |
Vendor Page | Anti EPPIN-WFDC6 pAb (ATL-HPA067335) |