Protein Description: erythropoietin receptor
Gene Name: EPOR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006235: 80%, ENSRNOG00000012619: 80%
Entrez Gene ID: 2057
Uniprot ID: P19235
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EPOR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006235: 80%, ENSRNOG00000012619: 80%
Entrez Gene ID: 2057
Uniprot ID: P19235
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS |
Documents & Links for Anti EPOR pAb (ATL-HPA077654) | |
Datasheet | Anti EPOR pAb (ATL-HPA077654) Datasheet (External Link) |
Vendor Page | Anti EPOR pAb (ATL-HPA077654) at Atlas |
Documents & Links for Anti EPOR pAb (ATL-HPA077654) | |
Datasheet | Anti EPOR pAb (ATL-HPA077654) Datasheet (External Link) |
Vendor Page | Anti EPOR pAb (ATL-HPA077654) |