Anti EPOR pAb (ATL-HPA077654)

Catalog No:
ATL-HPA077654-25
$395.00

Description

Product Description

Protein Description: erythropoietin receptor
Gene Name: EPOR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006235: 80%, ENSRNOG00000012619: 80%
Entrez Gene ID: 2057
Uniprot ID: P19235
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS
Gene Sequence SCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS
Gene ID - Mouse ENSMUSG00000006235
Gene ID - Rat ENSRNOG00000012619
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti EPOR pAb (ATL-HPA077654)
Datasheet Anti EPOR pAb (ATL-HPA077654) Datasheet (External Link)
Vendor Page Anti EPOR pAb (ATL-HPA077654) at Atlas Antibodies

Documents & Links for Anti EPOR pAb (ATL-HPA077654)
Datasheet Anti EPOR pAb (ATL-HPA077654) Datasheet (External Link)
Vendor Page Anti EPOR pAb (ATL-HPA077654)

Product Description

Protein Description: erythropoietin receptor
Gene Name: EPOR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006235: 80%, ENSRNOG00000012619: 80%
Entrez Gene ID: 2057
Uniprot ID: P19235
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS
Gene Sequence SCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS
Gene ID - Mouse ENSMUSG00000006235
Gene ID - Rat ENSRNOG00000012619
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti EPOR pAb (ATL-HPA077654)
Datasheet Anti EPOR pAb (ATL-HPA077654) Datasheet (External Link)
Vendor Page Anti EPOR pAb (ATL-HPA077654) at Atlas Antibodies

Documents & Links for Anti EPOR pAb (ATL-HPA077654)
Datasheet Anti EPOR pAb (ATL-HPA077654) Datasheet (External Link)
Vendor Page Anti EPOR pAb (ATL-HPA077654)