Description
Product Description
Protein Description: epsin 3
Gene Name: EPN3
Alternative Gene Name: FLJ20778, MGC129899
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010080: 87%, ENSRNOG00000003284: 93%
Entrez Gene ID: 55040
Uniprot ID: Q9H201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EPN3
Alternative Gene Name: FLJ20778, MGC129899
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010080: 87%, ENSRNOG00000003284: 93%
Entrez Gene ID: 55040
Uniprot ID: Q9H201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LGPSASSLVNLDSLVKAPQVAKTRNPFLTGLSAPSPTNPFGAGEPGRPTLNQMRT |
| Gene Sequence | LGPSASSLVNLDSLVKAPQVAKTRNPFLTGLSAPSPTNPFGAGEPGRPTLNQMRT |
| Gene ID - Mouse | ENSMUSG00000010080 |
| Gene ID - Rat | ENSRNOG00000003284 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti EPN3 pAb (ATL-HPA063224) | |
| Datasheet | Anti EPN3 pAb (ATL-HPA063224) Datasheet (External Link) |
| Vendor Page | Anti EPN3 pAb (ATL-HPA063224) at Atlas Antibodies |
| Documents & Links for Anti EPN3 pAb (ATL-HPA063224) | |
| Datasheet | Anti EPN3 pAb (ATL-HPA063224) Datasheet (External Link) |
| Vendor Page | Anti EPN3 pAb (ATL-HPA063224) |