Protein Description: epsin 1
Gene Name: EPN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035203: 89%, ENSRNOG00000015753: 86%
Entrez Gene ID: 29924
Uniprot ID: Q9Y6I3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EPN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035203: 89%, ENSRNOG00000015753: 86%
Entrez Gene ID: 29924
Uniprot ID: Q9Y6I3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PAGPSVDPWGGTPAPAAGEGPTPDPWGSSDGGVPVSGPSASDPWTPAPAFSDPWGGSPAKPSTNGTTAAG |
| Documents & Links for Anti EPN1 pAb (ATL-HPA071503) | |
| Datasheet | Anti EPN1 pAb (ATL-HPA071503) Datasheet (External Link) |
| Vendor Page | Anti EPN1 pAb (ATL-HPA071503) at Atlas |
| Documents & Links for Anti EPN1 pAb (ATL-HPA071503) | |
| Datasheet | Anti EPN1 pAb (ATL-HPA071503) Datasheet (External Link) |
| Vendor Page | Anti EPN1 pAb (ATL-HPA071503) |