Protein Description: epoxide hydrolase 1, microsomal (xenobiotic)
Gene Name: EPHX1
Alternative Gene Name: EPHX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038776: 83%, ENSRNOG00000003515: 83%
Entrez Gene ID: 2052
Uniprot ID: P07099
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EPHX1
Alternative Gene Name: EPHX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038776: 83%, ENSRNOG00000003515: 83%
Entrez Gene ID: 2052
Uniprot ID: P07099
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRHPHFKTKIEGLDIHFI |
Documents & Links for Anti EPHX1 pAb (ATL-HPA020593 w/enhanced validation) | |
Datasheet | Anti EPHX1 pAb (ATL-HPA020593 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti EPHX1 pAb (ATL-HPA020593 w/enhanced validation) at Atlas |
Documents & Links for Anti EPHX1 pAb (ATL-HPA020593 w/enhanced validation) | |
Datasheet | Anti EPHX1 pAb (ATL-HPA020593 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti EPHX1 pAb (ATL-HPA020593 w/enhanced validation) |