Anti EPHB2 pAb (ATL-HPA071200)

Atlas Antibodies

Catalog No: ATL-HPA071200-100

• 
• 

Product Description

Protein Description: EPH receptor B2
Gene Name: EPHB2
Alternative Gene Name: DRT, EPHT3, ERK, Hek5, Tyro5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028664: 100%, ENSRNOG00000012531: 100%
Entrez Gene ID: 2048
Uniprot ID: P29323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVI
• Gene Sequence: CRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVI
• Gene ID - Mouse: ENSMUSG00000028664
• Gene ID - Rat: ENSRNOG00000012531
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.