Protein Description: EPH receptor B1
Gene Name: EPHB1
Alternative Gene Name: EPHT2, Hek6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032537: 99%, ENSRNOG00000007865: 98%
Entrez Gene ID: 2047
Uniprot ID: P54762
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EPHB1
Alternative Gene Name: EPHT2, Hek6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032537: 99%, ENSRNOG00000007865: 98%
Entrez Gene ID: 2047
Uniprot ID: P54762
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNE |
| Documents & Links for Anti EPHB1 pAb (ATL-HPA067740 w/enhanced validation) | |
| Datasheet | Anti EPHB1 pAb (ATL-HPA067740 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EPHB1 pAb (ATL-HPA067740 w/enhanced validation) at Atlas |
| Documents & Links for Anti EPHB1 pAb (ATL-HPA067740 w/enhanced validation) | |
| Datasheet | Anti EPHB1 pAb (ATL-HPA067740 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EPHB1 pAb (ATL-HPA067740 w/enhanced validation) |