Protein Description: ependymin related 1
Gene Name: EPDR1
Alternative Gene Name: EPDR, MERP-1, MERP1, UCC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002808: 84%, ENSRNOG00000060141: 87%
Entrez Gene ID: 54749
Uniprot ID: Q9UM22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EPDR1
Alternative Gene Name: EPDR, MERP-1, MERP1, UCC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002808: 84%, ENSRNOG00000060141: 87%
Entrez Gene ID: 54749
Uniprot ID: Q9UM22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GRQVMYQQSSGRNSRALLSYDGLNQRVRVLDERKALIPCKRLFEYILLYKDGVMFQIDQATKQCSKMTLTQPWDPL |
| Documents & Links for Anti EPDR1 pAb (ATL-HPA072321 w/enhanced validation) | |
| Datasheet | Anti EPDR1 pAb (ATL-HPA072321 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EPDR1 pAb (ATL-HPA072321 w/enhanced validation) at Atlas |
| Documents & Links for Anti EPDR1 pAb (ATL-HPA072321 w/enhanced validation) | |
| Datasheet | Anti EPDR1 pAb (ATL-HPA072321 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EPDR1 pAb (ATL-HPA072321 w/enhanced validation) |