Anti EPB41L1 pAb (ATL-HPA056817 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA056817-25

• 
• 
• 

Product Description

Protein Description: erythrocyte membrane protein band 4.1-like 1
Gene Name: EPB41L1
Alternative Gene Name: KIAA0338
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027624: 91%, ENSRNOG00000055809: 93%
Entrez Gene ID: 2036
Uniprot ID: Q9H4G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KKAQEEAPQQPEAAAAVTTPVTPAGHGHPEANSNEKHPSQQDTRPAEQSLDMEEKDYSEADGLSERTTPSKAQKSPQKIAK
• Gene Sequence: KKAQEEAPQQPEAAAAVTTPVTPAGHGHPEANSNEKHPSQQDTRPAEQSLDMEEKDYSEADGLSERTTPSKAQKSPQKIAK
• Gene ID - Mouse: ENSMUSG00000027624
• Gene ID - Rat: ENSRNOG00000055809
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.