Protein Description: endothelial PAS domain protein 1
Gene Name: EPAS1
Alternative Gene Name: bHLHe73, HIF2A, HLF, MOP2, PASD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024140: 77%, ENSRNOG00000021318: 72%
Entrez Gene ID: 2034
Uniprot ID: Q99814
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EPAS1
Alternative Gene Name: bHLHe73, HIF2A, HLF, MOP2, PASD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024140: 77%, ENSRNOG00000021318: 72%
Entrez Gene ID: 2034
Uniprot ID: Q99814
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPP |
Documents & Links for Anti EPAS1 pAb (ATL-HPA069697) | |
Datasheet | Anti EPAS1 pAb (ATL-HPA069697) Datasheet (External Link) |
Vendor Page | Anti EPAS1 pAb (ATL-HPA069697) at Atlas |
Documents & Links for Anti EPAS1 pAb (ATL-HPA069697) | |
Datasheet | Anti EPAS1 pAb (ATL-HPA069697) Datasheet (External Link) |
Vendor Page | Anti EPAS1 pAb (ATL-HPA069697) |