Protein Description: eomesodermin
Gene Name: EOMES
Alternative Gene Name: TBR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032446: 96%, ENSRNOG00000042140: 96%
Entrez Gene ID: 8320
Uniprot ID: O95936
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EOMES
Alternative Gene Name: TBR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032446: 96%, ENSRNOG00000042140: 96%
Entrez Gene ID: 8320
Uniprot ID: O95936
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KGFRDNYDSMYTASENDRLTPSPTDSPRSHQIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPTV |
Gene Sequence | KGFRDNYDSMYTASENDRLTPSPTDSPRSHQIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPTV |
Gene ID - Mouse | ENSMUSG00000032446 |
Gene ID - Rat | ENSRNOG00000042140 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EOMES pAb (ATL-HPA028896) | |
Datasheet | Anti EOMES pAb (ATL-HPA028896) Datasheet (External Link) |
Vendor Page | Anti EOMES pAb (ATL-HPA028896) at Atlas |
Documents & Links for Anti EOMES pAb (ATL-HPA028896) | |
Datasheet | Anti EOMES pAb (ATL-HPA028896) Datasheet (External Link) |
Vendor Page | Anti EOMES pAb (ATL-HPA028896) |
Citations for Anti EOMES pAb (ATL-HPA028896) – 3 Found |
González-Arnay, Emilio; González-Gómez, Miriam; Meyer, Gundela. A Radial Glia Fascicle Leads Principal Neurons from the Pallial-Subpallial Boundary into the Developing Human Insula. Frontiers In Neuroanatomy. 11( 29259547):111. PubMed |
Yamashita, Wataru; Takahashi, Masanori; Kikkawa, Takako; Gotoh, Hitoshi; Osumi, Noriko; Ono, Katsuhiko; Nomura, Tadashi. Conserved and divergent functions of Pax6 underlie species-specific neurogenic patterns in the developing amniote brain. Development (Cambridge, England). 2018;145(8) PubMed |
Kim, Bumsoo; Koh, Yongjun; Do, Hyunsu; Ju, Younghee; Choi, Jong Bin; Cho, Gahyang; Yoo, Han-Wook; Lee, Beom Hee; Han, Jinju; Park, Jong-Eun; Han, Yong-Mahn. Aberrant Cortical Layer Development of Brain Organoids Derived from Noonan Syndrome-iPSCs. International Journal Of Molecular Sciences. 2022;23(22) PubMed |