Protein Description: endoglin
Gene Name: ENG
Alternative Gene Name: CD105, END, HHT1, ORW, ORW1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026814: 70%, ENSRNOG00000050190: 78%
Entrez Gene ID: 2022
Uniprot ID: P17813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ENG
Alternative Gene Name: CD105, END, HHT1, ORW, ORW1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026814: 70%, ENSRNOG00000050190: 78%
Entrez Gene ID: 2022
Uniprot ID: P17813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNAS |
| Documents & Links for Anti ENG pAb (ATL-HPA067440 w/enhanced validation) | |
| Datasheet | Anti ENG pAb (ATL-HPA067440 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ENG pAb (ATL-HPA067440 w/enhanced validation) at Atlas |
| Documents & Links for Anti ENG pAb (ATL-HPA067440 w/enhanced validation) | |
| Datasheet | Anti ENG pAb (ATL-HPA067440 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ENG pAb (ATL-HPA067440 w/enhanced validation) |
| Citations for Anti ENG pAb (ATL-HPA067440 w/enhanced validation) – 1 Found |
| Krueger, Timothy E; Thorek, Daniel L J; Meeker, Alan K; Isaacs, John T; Brennen, W Nathaniel. Tumor-infiltrating mesenchymal stem cells: Drivers of the immunosuppressive tumor microenvironment in prostate cancer?. The Prostate. 2019;79(3):320-330. PubMed |