Protein Description: endonuclease, polyU-specific
Gene Name: ENDOU
Alternative Gene Name: P11, PP11, PRSS26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022468: 64%, ENSRNOG00000056446: 64%
Entrez Gene ID: 8909
Uniprot ID: P21128
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ENDOU
Alternative Gene Name: P11, PP11, PRSS26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022468: 64%, ENSRNOG00000056446: 64%
Entrez Gene ID: 8909
Uniprot ID: P21128
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KIESCASRCNEKFNRDAACQCDRRCLWHGNCCEDYEHLCTEDHKESEPLPQLEEETEEALASNLYSAPTSCQGRCYEAFDKHHQCHCNARCQ |
| Documents & Links for Anti ENDOU pAb (ATL-HPA067448 w/enhanced validation) | |
| Datasheet | Anti ENDOU pAb (ATL-HPA067448 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ENDOU pAb (ATL-HPA067448 w/enhanced validation) at Atlas |
| Documents & Links for Anti ENDOU pAb (ATL-HPA067448 w/enhanced validation) | |
| Datasheet | Anti ENDOU pAb (ATL-HPA067448 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ENDOU pAb (ATL-HPA067448 w/enhanced validation) |
| Citations for Anti ENDOU pAb (ATL-HPA067448 w/enhanced validation) – 1 Found |
| Hornbachner, Ruth; Lackner, Andreas; Papuchova, Henrieta; Haider, Sandra; Knöfler, Martin; Mechtler, Karl; Latos, Paulina A. MSX2 safeguards syncytiotrophoblast fate of human trophoblast stem cells. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2021;118(37) PubMed |