Anti EML6 pAb (ATL-HPA062808)

Atlas Antibodies

Catalog No: ATL-HPA062808-25

• 

Product Description

Protein Description: echinoderm microtubule associated protein like 6
Gene Name: EML6
Alternative Gene Name: FLJ42562
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044072: 98%, ENSRNOG00000037462: 98%
Entrez Gene ID: 400954
Uniprot ID: Q6ZMW3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TNVRWLHNDSVLLTVGGADTALMIWTREFVGTQESKLVDSEESDTDVEEDG
• Gene Sequence: TNVRWLHNDSVLLTVGGADTALMIWTREFVGTQESKLVDSEESDTDVEEDG
• Gene ID - Mouse: ENSMUSG00000044072
• Gene ID - Rat: ENSRNOG00000037462
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.