![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line HepG2](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99602/179215/atl-hpa065337_anti-eml4-pab-atl-hpa065337-wenhanced-validation_60877__44971.1681134862.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line HepG2")
Protein Description: echinoderm microtubule associated protein like 4
Gene Name: EML4
Alternative Gene Name: C2orf2, ELP120, ROPP120
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032624: 94%, ENSRNOG00000030294: 95%
Entrez Gene ID: 27436
Uniprot ID: Q9HC35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EML4
Alternative Gene Name: C2orf2, ELP120, ROPP120
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032624: 94%, ENSRNOG00000030294: 95%
Entrez Gene ID: 27436
Uniprot ID: Q9HC35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GGVMLIWSKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGKDRKIILWDHDLNPEREIEVPDQYGTI |
| Documents & Links for Anti EML4 pAb (ATL-HPA065337 w/enhanced validation) | |
| Datasheet | Anti EML4 pAb (ATL-HPA065337 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EML4 pAb (ATL-HPA065337 w/enhanced validation) at Atlas |
| Documents & Links for Anti EML4 pAb (ATL-HPA065337 w/enhanced validation) | |
| Datasheet | Anti EML4 pAb (ATL-HPA065337 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EML4 pAb (ATL-HPA065337 w/enhanced validation) |