Protein Description: echinoderm microtubule associated protein like 4
Gene Name: EML4
Alternative Gene Name: C2orf2, ELP120, ROPP120
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032624: 94%, ENSRNOG00000030294: 95%
Entrez Gene ID: 27436
Uniprot ID: Q9HC35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EML4
Alternative Gene Name: C2orf2, ELP120, ROPP120
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032624: 94%, ENSRNOG00000030294: 95%
Entrez Gene ID: 27436
Uniprot ID: Q9HC35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GGVMLIWSKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGKDRKIILWDHDLNPEREIEVPDQYGTI |
Documents & Links for Anti EML4 pAb (ATL-HPA065337 w/enhanced validation) | |
Datasheet | Anti EML4 pAb (ATL-HPA065337 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti EML4 pAb (ATL-HPA065337 w/enhanced validation) at Atlas |
Documents & Links for Anti EML4 pAb (ATL-HPA065337 w/enhanced validation) | |
Datasheet | Anti EML4 pAb (ATL-HPA065337 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti EML4 pAb (ATL-HPA065337 w/enhanced validation) |