Description
Product Description
Protein Description: elastin microfibril interfacer 3
Gene Name: EMILIN3
Alternative Gene Name: C20orf130, dJ620E11.4, EMILIN5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050700: 85%, ENSRNOG00000016734: 85%
Entrez Gene ID: 90187
Uniprot ID: Q9NT22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EMILIN3
Alternative Gene Name: C20orf130, dJ620E11.4, EMILIN5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050700: 85%, ENSRNOG00000016734: 85%
Entrez Gene ID: 90187
Uniprot ID: Q9NT22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLEEYVDRRLHRLWGSLLDGFEQKLQGVQSECDLRVQEVRRQCEEGQAASRRLHQSLDGRELALRQELSQLGSQLQGLSVSGRGSCCGQLALINARMDG |
Gene Sequence | LLEEYVDRRLHRLWGSLLDGFEQKLQGVQSECDLRVQEVRRQCEEGQAASRRLHQSLDGRELALRQELSQLGSQLQGLSVSGRGSCCGQLALINARMDG |
Gene ID - Mouse | ENSMUSG00000050700 |
Gene ID - Rat | ENSRNOG00000016734 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti EMILIN3 pAb (ATL-HPA078559) | |
Datasheet | Anti EMILIN3 pAb (ATL-HPA078559) Datasheet (External Link) |
Vendor Page | Anti EMILIN3 pAb (ATL-HPA078559) at Atlas Antibodies |
Documents & Links for Anti EMILIN3 pAb (ATL-HPA078559) | |
Datasheet | Anti EMILIN3 pAb (ATL-HPA078559) Datasheet (External Link) |
Vendor Page | Anti EMILIN3 pAb (ATL-HPA078559) |