Protein Description: ER membrane protein complex subunit 9
Gene Name: EMC9
Alternative Gene Name: C14orf122, CGI-112, FAM158A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022217: 92%, ENSRNOG00000019162: 92%
Entrez Gene ID: 51016
Uniprot ID: Q9Y3B6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EMC9
Alternative Gene Name: C14orf122, CGI-112, FAM158A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022217: 92%, ENSRNOG00000019162: 92%
Entrez Gene ID: 51016
Uniprot ID: Q9Y3B6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDC |
| Documents & Links for Anti EMC9 pAb (ATL-HPA078254) | |
| Datasheet | Anti EMC9 pAb (ATL-HPA078254) Datasheet (External Link) |
| Vendor Page | Anti EMC9 pAb (ATL-HPA078254) at Atlas |
| Documents & Links for Anti EMC9 pAb (ATL-HPA078254) | |
| Datasheet | Anti EMC9 pAb (ATL-HPA078254) Datasheet (External Link) |
| Vendor Page | Anti EMC9 pAb (ATL-HPA078254) |