Anti EMC9 pAb (ATL-HPA078254)

Catalog No:
ATL-HPA078254-25
$447.00

Description

Product Description

Protein Description: ER membrane protein complex subunit 9
Gene Name: EMC9
Alternative Gene Name: C14orf122, CGI-112, FAM158A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022217: 92%, ENSRNOG00000019162: 92%
Entrez Gene ID: 51016
Uniprot ID: Q9Y3B6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDC
Gene Sequence AEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDC
Gene ID - Mouse ENSMUSG00000022217
Gene ID - Rat ENSRNOG00000019162
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti EMC9 pAb (ATL-HPA078254)
Datasheet Anti EMC9 pAb (ATL-HPA078254) Datasheet (External Link)
Vendor Page Anti EMC9 pAb (ATL-HPA078254) at Atlas Antibodies

Documents & Links for Anti EMC9 pAb (ATL-HPA078254)
Datasheet Anti EMC9 pAb (ATL-HPA078254) Datasheet (External Link)
Vendor Page Anti EMC9 pAb (ATL-HPA078254)

Product Description

Protein Description: ER membrane protein complex subunit 9
Gene Name: EMC9
Alternative Gene Name: C14orf122, CGI-112, FAM158A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022217: 92%, ENSRNOG00000019162: 92%
Entrez Gene ID: 51016
Uniprot ID: Q9Y3B6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDC
Gene Sequence AEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDC
Gene ID - Mouse ENSMUSG00000022217
Gene ID - Rat ENSRNOG00000019162
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti EMC9 pAb (ATL-HPA078254)
Datasheet Anti EMC9 pAb (ATL-HPA078254) Datasheet (External Link)
Vendor Page Anti EMC9 pAb (ATL-HPA078254) at Atlas Antibodies

Documents & Links for Anti EMC9 pAb (ATL-HPA078254)
Datasheet Anti EMC9 pAb (ATL-HPA078254) Datasheet (External Link)
Vendor Page Anti EMC9 pAb (ATL-HPA078254)