Protein Description: elongin C
Gene Name: ELOC
Alternative Gene Name: SIII, TCEB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079658: 100%, ENSRNOG00000031730: 100%
Entrez Gene ID: 6921
Uniprot ID: Q15369
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ELOC
Alternative Gene Name: SIII, TCEB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079658: 100%, ENSRNOG00000031730: 100%
Entrez Gene ID: 6921
Uniprot ID: Q15369
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEI |
| Gene ID - Mouse | ENSMUSG00000079658 |
| Gene ID - Rat | ENSMUSG00000079658 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ELOC pAb (ATL-HPA078113) | |
| Datasheet | Anti ELOC pAb (ATL-HPA078113) Datasheet (External Link) |
| Vendor Page | Anti ELOC pAb (ATL-HPA078113) at Atlas |
| Documents & Links for Anti ELOC pAb (ATL-HPA078113) | |
| Datasheet | Anti ELOC pAb (ATL-HPA078113) Datasheet (External Link) |
| Vendor Page | Anti ELOC pAb (ATL-HPA078113) |