Anti ELOC pAb (ATL-HPA078113)

Catalog No:
ATL-HPA078113-25
$395.00

Description

Product Description

Protein Description: elongin C
Gene Name: ELOC
Alternative Gene Name: SIII, TCEB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079658: 100%, ENSRNOG00000031730: 100%
Entrez Gene ID: 6921
Uniprot ID: Q15369
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEI
Gene Sequence ETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEI
Gene ID - Mouse ENSMUSG00000079658
Gene ID - Rat ENSRNOG00000031730
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ELOC pAb (ATL-HPA078113)
Datasheet Anti ELOC pAb (ATL-HPA078113) Datasheet (External Link)
Vendor Page Anti ELOC pAb (ATL-HPA078113) at Atlas Antibodies

Documents & Links for Anti ELOC pAb (ATL-HPA078113)
Datasheet Anti ELOC pAb (ATL-HPA078113) Datasheet (External Link)
Vendor Page Anti ELOC pAb (ATL-HPA078113)

Product Description

Protein Description: elongin C
Gene Name: ELOC
Alternative Gene Name: SIII, TCEB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079658: 100%, ENSRNOG00000031730: 100%
Entrez Gene ID: 6921
Uniprot ID: Q15369
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEI
Gene Sequence ETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEI
Gene ID - Mouse ENSMUSG00000079658
Gene ID - Rat ENSRNOG00000031730
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ELOC pAb (ATL-HPA078113)
Datasheet Anti ELOC pAb (ATL-HPA078113) Datasheet (External Link)
Vendor Page Anti ELOC pAb (ATL-HPA078113) at Atlas Antibodies

Documents & Links for Anti ELOC pAb (ATL-HPA078113)
Datasheet Anti ELOC pAb (ATL-HPA078113) Datasheet (External Link)
Vendor Page Anti ELOC pAb (ATL-HPA078113)