![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99270/178762/atl-hpa064006_anti-elob-pab-atl-hpa064006_60424__18876.1681134312.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: elongin B
Gene Name: ELOB
Alternative Gene Name: SIII, TCEB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055839: 98%, ENSRNOG00000004814: 98%
Entrez Gene ID: 6923
Uniprot ID: Q15370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ELOB
Alternative Gene Name: SIII, TCEB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055839: 98%, ENSRNOG00000004814: 98%
Entrez Gene ID: 6923
Uniprot ID: Q15370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSS |
| Documents & Links for Anti ELOB pAb (ATL-HPA064006) | |
| Datasheet | Anti ELOB pAb (ATL-HPA064006) Datasheet (External Link) |
| Vendor Page | Anti ELOB pAb (ATL-HPA064006) at Atlas |
| Documents & Links for Anti ELOB pAb (ATL-HPA064006) | |
| Datasheet | Anti ELOB pAb (ATL-HPA064006) Datasheet (External Link) |
| Vendor Page | Anti ELOB pAb (ATL-HPA064006) |