Anti ELN pAb (ATL-HPA056941)

Atlas Antibodies

Catalog No: ATL-HPA056941-25

• 
• 

Product Description

Protein Description: elastin
Gene Name: ELN
Alternative Gene Name: SVAS, WBS, WS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029675: 57%, ENSRNOG00000001469: 56%
Entrez Gene ID: 2006
Uniprot ID: P15502
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGGLGVPGVGGLGGIPPAAAAKAAKYGAAGLGGVLGGAGQFPLGGVAARPGFGLSPIFPGGACLGKACGRKR
• Gene Sequence: VGGLGVPGVGGLGGIPPAAAAKAAKYGAAGLGGVLGGAGQFPLGGVAARPGFGLSPIFPGGACLGKACGRKR
• Gene ID - Mouse: ENSMUSG00000029675
• Gene ID - Rat: ENSRNOG00000001469
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.