Protein Description: elongation factor for RNA polymerase II 3
Gene Name: ELL3
Alternative Gene Name: FLJ22637
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027246: 70%, ENSRNOG00000022868: 70%
Entrez Gene ID: 80237
Uniprot ID: Q9HB65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ELL3
Alternative Gene Name: FLJ22637
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027246: 70%, ENSRNOG00000022868: 70%
Entrez Gene ID: 80237
Uniprot ID: Q9HB65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LPLVPSPLQGLTNQDLQEGEDWEQEDEDMDPRLEHSSSVQEDSESPSPEDIPDYLLQYRAIHSAEQQHAYE |
Documents & Links for Anti ELL3 pAb (ATL-HPA073494) | |
Datasheet | Anti ELL3 pAb (ATL-HPA073494) Datasheet (External Link) |
Vendor Page | Anti ELL3 pAb (ATL-HPA073494) at Atlas |
Documents & Links for Anti ELL3 pAb (ATL-HPA073494) | |
Datasheet | Anti ELL3 pAb (ATL-HPA073494) Datasheet (External Link) |
Vendor Page | Anti ELL3 pAb (ATL-HPA073494) |