Description
Product Description
Protein Description: elongation factor RNA polymerase II
Gene Name: ELL
Alternative Gene Name: C19orf17, ELL1, Men, PPP1R68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070002: 73%, ENSRNOG00000019824: 74%
Entrez Gene ID: 8178
Uniprot ID: P55199
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ELL
Alternative Gene Name: C19orf17, ELL1, Men, PPP1R68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070002: 73%, ENSRNOG00000019824: 74%
Entrez Gene ID: 8178
Uniprot ID: P55199
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTGSLLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLG |
Gene Sequence | ANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTGSLLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLG |
Gene ID - Mouse | ENSMUSG00000070002 |
Gene ID - Rat | ENSRNOG00000019824 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ELL pAb (ATL-HPA046076) | |
Datasheet | Anti ELL pAb (ATL-HPA046076) Datasheet (External Link) |
Vendor Page | Anti ELL pAb (ATL-HPA046076) at Atlas Antibodies |
Documents & Links for Anti ELL pAb (ATL-HPA046076) | |
Datasheet | Anti ELL pAb (ATL-HPA046076) Datasheet (External Link) |
Vendor Page | Anti ELL pAb (ATL-HPA046076) |
Citations
Citations for Anti ELL pAb (ATL-HPA046076) – 1 Found |
Chen, Yu; Zhou, Chi; Ji, Wei; Mei, Zhichao; Hu, Bo; Zhang, Wei; Zhang, Dawei; Wang, Jing; Liu, Xing; Ouyang, Gang; Zhou, Jiangang; Xiao, Wuhan. ELL targets c-Myc for proteasomal degradation and suppresses tumour growth. Nature Communications. 2016;7( 27009366):11057. PubMed |