Protein Description: ELK1, member of ETS oncogene family
Gene Name: ELK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009406: 86%, ENSRNOG00000010171: 83%
Entrez Gene ID: 2002
Uniprot ID: P19419
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ELK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009406: 86%, ENSRNOG00000010171: 83%
Entrez Gene ID: 2002
Uniprot ID: P19419
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSL |
Documents & Links for Anti ELK1 pAb (ATL-HPA064381) | |
Datasheet | Anti ELK1 pAb (ATL-HPA064381) Datasheet (External Link) |
Vendor Page | Anti ELK1 pAb (ATL-HPA064381) at Atlas |
Documents & Links for Anti ELK1 pAb (ATL-HPA064381) | |
Datasheet | Anti ELK1 pAb (ATL-HPA064381) Datasheet (External Link) |
Vendor Page | Anti ELK1 pAb (ATL-HPA064381) |