Anti ELK1 pAb (ATL-HPA064381)

Atlas Antibodies

Catalog No: ATL-HPA064381-25

• 

Product Description

Protein Description: ELK1, member of ETS oncogene family
Gene Name: ELK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009406: 86%, ENSRNOG00000010171: 83%
Entrez Gene ID: 2002
Uniprot ID: P19419
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSL
• Gene Sequence: FVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSL
• Gene ID - Mouse: ENSMUSG00000009406
• Gene ID - Rat: ENSRNOG00000010171
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.