Description
Product Description
Protein Description: E74-like factor 5 (ets domain transcription factor)
Gene Name: ELF5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027186: 96%, ENSRNOG00000058235: 100%
Entrez Gene ID: 2001
Uniprot ID: Q9UKW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ELF5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027186: 96%, ENSRNOG00000058235: 100%
Entrez Gene ID: 2001
Uniprot ID: Q9UKW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QDCHSHSRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMW |
| Gene Sequence | QDCHSHSRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMW |
| Gene ID - Mouse | ENSMUSG00000027186 |
| Gene ID - Rat | ENSRNOG00000058235 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti ELF5 pAb (ATL-HPA062706) | |
| Datasheet | Anti ELF5 pAb (ATL-HPA062706) Datasheet (External Link) |
| Vendor Page | Anti ELF5 pAb (ATL-HPA062706) at Atlas Antibodies |
| Documents & Links for Anti ELF5 pAb (ATL-HPA062706) | |
| Datasheet | Anti ELF5 pAb (ATL-HPA062706) Datasheet (External Link) |
| Vendor Page | Anti ELF5 pAb (ATL-HPA062706) |