Protein Description: E74-like factor 2 (ets domain transcription factor)
Gene Name: ELF2
Alternative Gene Name: EU32, NERF, NERF-1A, NERF-1B, NERF-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037174: 91%, ENSRNOG00000010815: 95%
Entrez Gene ID: 1998
Uniprot ID: Q15723
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ELF2
Alternative Gene Name: EU32, NERF, NERF-1A, NERF-1B, NERF-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037174: 91%, ENSRNOG00000010815: 95%
Entrez Gene ID: 1998
Uniprot ID: Q15723
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TQQASGQTPPRVISAVIKGPEVKSEAVAKKQEHDVKTLQLVEEKPADGNKTVTHVVVVSAPSAIALPVTMKTEGLVTCEK |
Documents & Links for Anti ELF2 pAb (ATL-HPA071166 w/enhanced validation) | |
Datasheet | Anti ELF2 pAb (ATL-HPA071166 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ELF2 pAb (ATL-HPA071166 w/enhanced validation) at Atlas |
Documents & Links for Anti ELF2 pAb (ATL-HPA071166 w/enhanced validation) | |
Datasheet | Anti ELF2 pAb (ATL-HPA071166 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ELF2 pAb (ATL-HPA071166 w/enhanced validation) |