Protein Description: ELAV like neuron-specific RNA binding protein 2
Gene Name: ELAVL2
Alternative Gene Name: HEL-N1, HuB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008489: 99%, ENSRNOG00000006853: 99%
Entrez Gene ID: 1993
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ELAVL2
Alternative Gene Name: HEL-N1, HuB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008489: 99%, ENSRNOG00000006853: 99%
Entrez Gene ID: 1993
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MAVRLCDVASLLRSGSWAAEPWTGQVIAAMETQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNL |
| Documents & Links for Anti ELAVL2 pAb (ATL-HPA063001 w/enhanced validation) | |
| Datasheet | Anti ELAVL2 pAb (ATL-HPA063001 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ELAVL2 pAb (ATL-HPA063001 w/enhanced validation) at Atlas |
| Documents & Links for Anti ELAVL2 pAb (ATL-HPA063001 w/enhanced validation) | |
| Datasheet | Anti ELAVL2 pAb (ATL-HPA063001 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ELAVL2 pAb (ATL-HPA063001 w/enhanced validation) |
| Citations for Anti ELAVL2 pAb (ATL-HPA063001 w/enhanced validation) – 2 Found |
| Jan, Sabrina Z; Vormer, Tinke L; Jongejan, Aldo; Röling, Michael D; Silber, Sherman J; de Rooij, Dirk G; Hamer, Geert; Repping, Sjoerd; van Pelt, Ans M M. Unraveling transcriptome dynamics in human spermatogenesis. Development (Cambridge, England). 2017;144(20):3659-3673. PubMed |
| Pandit, Kunal; Petrescu, Joana; Cuevas, Miguel; Stephenson, William; Smibert, Peter; Phatnani, Hemali; Maniatis, Silas. An open source toolkit for repurposing Illumina sequencing systems as versatile fluidics and imaging platforms. Scientific Reports. 2022;12(1):5081. PubMed |