Protein Description: elastase, neutrophil expressed
Gene Name: ELANE
Alternative Gene Name: ELA2, HLE, HNE, NE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020125: 65%, ENSRNOG00000033685: 63%
Entrez Gene ID: 1991
Uniprot ID: P08246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ELANE
Alternative Gene Name: ELA2, HLE, HNE, NE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020125: 65%, ENSRNOG00000033685: 63%
Entrez Gene ID: 1991
Uniprot ID: P08246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHP |
Documents & Links for Anti ELANE pAb (ATL-HPA066836 w/enhanced validation) | |
Datasheet | Anti ELANE pAb (ATL-HPA066836 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ELANE pAb (ATL-HPA066836 w/enhanced validation) at Atlas |
Documents & Links for Anti ELANE pAb (ATL-HPA066836 w/enhanced validation) | |
Datasheet | Anti ELANE pAb (ATL-HPA066836 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ELANE pAb (ATL-HPA066836 w/enhanced validation) |