Protein Description: eukaryotic translation initiation factor 4E family member 3
Gene Name: EIF4E3
Alternative Gene Name: MGC39820
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093661: 96%, ENSRNOG00000010301: 96%
Entrez Gene ID: 317649
Uniprot ID: Q8N5X7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EIF4E3
Alternative Gene Name: MGC39820
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093661: 96%, ENSRNOG00000010301: 96%
Entrez Gene ID: 317649
Uniprot ID: Q8N5X7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIY |
| Documents & Links for Anti EIF4E3 pAb (ATL-HPA076465) | |
| Datasheet | Anti EIF4E3 pAb (ATL-HPA076465) Datasheet (External Link) |
| Vendor Page | Anti EIF4E3 pAb (ATL-HPA076465) at Atlas |
| Documents & Links for Anti EIF4E3 pAb (ATL-HPA076465) | |
| Datasheet | Anti EIF4E3 pAb (ATL-HPA076465) Datasheet (External Link) |
| Vendor Page | Anti EIF4E3 pAb (ATL-HPA076465) |