![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101726/181885/atl-hpa077074_anti-eif4e2-pab-atl-hpa077074_63553__33664.1681138314.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG")
Protein Description: eukaryotic translation initiation factor 4E family member 2
Gene Name: EIF4E2
Alternative Gene Name: 4EHP, EIF4EL3, IF4e
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026254: 100%, ENSRNOG00000019634: 100%
Entrez Gene ID: 9470
Uniprot ID: O60573
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EIF4E2
Alternative Gene Name: 4EHP, EIF4EL3, IF4e
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026254: 100%, ENSRNOG00000019634: 100%
Entrez Gene ID: 9470
Uniprot ID: O60573
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQAT |
| Documents & Links for Anti EIF4E2 pAb (ATL-HPA077074) | |
| Datasheet | Anti EIF4E2 pAb (ATL-HPA077074) Datasheet (External Link) |
| Vendor Page | Anti EIF4E2 pAb (ATL-HPA077074) at Atlas |
| Documents & Links for Anti EIF4E2 pAb (ATL-HPA077074) | |
| Datasheet | Anti EIF4E2 pAb (ATL-HPA077074) Datasheet (External Link) |
| Vendor Page | Anti EIF4E2 pAb (ATL-HPA077074) |