Anti EIF4E2 pAb (ATL-HPA077074)

Atlas Antibodies

Catalog No: ATL-HPA077074-25

• 
• 

Product Description

Protein Description: eukaryotic translation initiation factor 4E family member 2
Gene Name: EIF4E2
Alternative Gene Name: 4EHP, EIF4EL3, IF4e
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026254: 100%, ENSRNOG00000019634: 100%
Entrez Gene ID: 9470
Uniprot ID: O60573
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQAT
• Gene Sequence: LRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQAT
• Gene ID - Mouse: ENSMUSG00000026254
• Gene ID - Rat: ENSRNOG00000019634
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.