![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99786/179458/atl-hpa066216_anti-eif3d-pab-atl-hpa066216_61120__51132.1681135156.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG")
Protein Description: eukaryotic translation initiation factor 3, subunit D
Gene Name: EIF3D
Alternative Gene Name: eIF3-p66, eIF3-zeta, eIF3d, EIF3S7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016554: 100%, ENSRNOG00000005804: 100%
Entrez Gene ID: 8664
Uniprot ID: O15371
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EIF3D
Alternative Gene Name: eIF3-p66, eIF3-zeta, eIF3d, EIF3S7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016554: 100%, ENSRNOG00000005804: 100%
Entrez Gene ID: 8664
Uniprot ID: O15371
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQGNVFATDAILATLMSCTRSVYSWDI |
| Documents & Links for Anti EIF3D pAb (ATL-HPA066216) | |
| Datasheet | Anti EIF3D pAb (ATL-HPA066216) Datasheet (External Link) |
| Vendor Page | Anti EIF3D pAb (ATL-HPA066216) at Atlas |
| Documents & Links for Anti EIF3D pAb (ATL-HPA066216) | |
| Datasheet | Anti EIF3D pAb (ATL-HPA066216) Datasheet (External Link) |
| Vendor Page | Anti EIF3D pAb (ATL-HPA066216) |