Anti EIF3D pAb (ATL-HPA063330)

Catalog No:
ATL-HPA063330-100
$596.00

Description

Product Description

Protein Description: eukaryotic translation initiation factor 3, subunit D
Gene Name: EIF3D
Alternative Gene Name: eIF3-p66, eIF3-zeta, eIF3d, EIF3S7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016554: 99%, ENSRNOG00000005804: 99%
Entrez Gene ID: 8664
Uniprot ID: O15371
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEE
Gene Sequence IVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEE
Gene ID - Mouse ENSMUSG00000016554
Gene ID - Rat ENSRNOG00000005804
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti EIF3D pAb (ATL-HPA063330)
Datasheet Anti EIF3D pAb (ATL-HPA063330) Datasheet (External Link)
Vendor Page Anti EIF3D pAb (ATL-HPA063330) at Atlas Antibodies

Documents & Links for Anti EIF3D pAb (ATL-HPA063330)
Datasheet Anti EIF3D pAb (ATL-HPA063330) Datasheet (External Link)
Vendor Page Anti EIF3D pAb (ATL-HPA063330)

Product Description

Protein Description: eukaryotic translation initiation factor 3, subunit D
Gene Name: EIF3D
Alternative Gene Name: eIF3-p66, eIF3-zeta, eIF3d, EIF3S7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016554: 99%, ENSRNOG00000005804: 99%
Entrez Gene ID: 8664
Uniprot ID: O15371
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEE
Gene Sequence IVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEE
Gene ID - Mouse ENSMUSG00000016554
Gene ID - Rat ENSRNOG00000005804
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti EIF3D pAb (ATL-HPA063330)
Datasheet Anti EIF3D pAb (ATL-HPA063330) Datasheet (External Link)
Vendor Page Anti EIF3D pAb (ATL-HPA063330) at Atlas Antibodies

Documents & Links for Anti EIF3D pAb (ATL-HPA063330)
Datasheet Anti EIF3D pAb (ATL-HPA063330) Datasheet (External Link)
Vendor Page Anti EIF3D pAb (ATL-HPA063330)