Anti EIF3A pAb (ATL-HPA038315 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA038315-25

• 
• 

Protein Description: eukaryotic translation initiation factor 3, subunit A
Gene Name: EIF3A
Alternative Gene Name: EIF3, eIF3-p170, eIF3-theta, eIF3a, EIF3S10, KIAA0139, TIF32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024991: 97%, ENSRNOG00000010117: 99%
Entrez Gene ID: 8661
Uniprot ID: Q14152
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAPIG
• Gene Sequence: LQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAPIG
• Gene ID - Mouse: ENSMUSG00000024991
• Gene ID - Rat: ENSRNOG00000010117
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EIF3A pAb (ATL-HPA038315 w/enhanced validation) – 1 Found

Malvi, Parmanand; Wang, Biao; Shah, Shreni; Gupta, Romi. Dissecting the role of RNA modification regulatory proteins in melanoma. Oncotarget. 2019;10(38):3745-3759.