Description
Product Description
Protein Description: eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa
Gene Name: EIF2S1
Alternative Gene Name: EIF-2alpha, EIF2, EIF2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021116: 97%, ENSRNOG00000009432: 97%
Entrez Gene ID: 1965
Uniprot ID: P05198
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EIF2S1
Alternative Gene Name: EIF-2alpha, EIF2, EIF2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021116: 97%, ENSRNOG00000009432: 97%
Entrez Gene ID: 1965
Uniprot ID: P05198
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEVDG |
Gene Sequence | IAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEVDG |
Gene ID - Mouse | ENSMUSG00000021116 |
Gene ID - Rat | ENSRNOG00000009432 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti EIF2S1 pAb (ATL-HPA064885) | |
Datasheet | Anti EIF2S1 pAb (ATL-HPA064885) Datasheet (External Link) |
Vendor Page | Anti EIF2S1 pAb (ATL-HPA064885) at Atlas Antibodies |
Documents & Links for Anti EIF2S1 pAb (ATL-HPA064885) | |
Datasheet | Anti EIF2S1 pAb (ATL-HPA064885) Datasheet (External Link) |
Vendor Page | Anti EIF2S1 pAb (ATL-HPA064885) |
Citations
Citations for Anti EIF2S1 pAb (ATL-HPA064885) – 1 Found |
Wollen, Kristian Lied; Hagen, Lars; Vågbø, Cathrine B; Rabe, Renana; Iveland, Tobias S; Aas, Per Arne; Sharma, Animesh; Sporsheim, Bjørnar; Erlandsen, Hilde O; Palibrk, Vuk; Bjørås, Magnar; Fonseca, Davi M; Mosammaparast, Nima; Slupphaug, Geir. ALKBH3 partner ASCC3 mediates P-body formation and selective clearance of MMS-induced 1-methyladenosine and 3-methylcytosine from mRNA. Journal Of Translational Medicine. 2021;19(1):287. PubMed |