Anti EIF2B5 pAb (ATL-HPA069303)

Atlas Antibodies

Catalog No: ATL-HPA069303-25

• 

Product Description

Protein Description: eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa
Gene Name: EIF2B5
Alternative Gene Name: EIF-2B, EIF2Bepsilon
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003235: 84%, ENSRNOG00000038160: 89%
Entrez Gene ID: 8893
Uniprot ID: Q13144
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLL
• Gene Sequence: MDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLL
• Gene ID - Mouse: ENSMUSG00000003235
• Gene ID - Rat: ENSRNOG00000038160
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.