Protein Description: eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa
Gene Name: EIF2B5
Alternative Gene Name: EIF-2B, EIF2Bepsilon
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003235: 90%, ENSRNOG00000038160: 88%
Entrez Gene ID: 8893
Uniprot ID: Q13144
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EIF2B5
Alternative Gene Name: EIF-2B, EIF2Bepsilon
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003235: 90%, ENSRNOG00000038160: 88%
Entrez Gene ID: 8893
Uniprot ID: Q13144
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SILEENVLLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVKERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPD |
Documents & Links for Anti EIF2B5 pAb (ATL-HPA064370) | |
Datasheet | Anti EIF2B5 pAb (ATL-HPA064370) Datasheet (External Link) |
Vendor Page | Anti EIF2B5 pAb (ATL-HPA064370) at Atlas |
Documents & Links for Anti EIF2B5 pAb (ATL-HPA064370) | |
Datasheet | Anti EIF2B5 pAb (ATL-HPA064370) Datasheet (External Link) |
Vendor Page | Anti EIF2B5 pAb (ATL-HPA064370) |