Protein Description: eukaryotic translation initiation factor 2-alpha kinase 2
Gene Name: EIF2AK2
Alternative Gene Name: EIF2AK1, PKR, PPP1R83, PRKR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024079: 53%, ENSRNOG00000048315: 60%
Entrez Gene ID: 5610
Uniprot ID: P19525
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EIF2AK2
Alternative Gene Name: EIF2AK1, PKR, PPP1R83, PRKR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024079: 53%, ENSRNOG00000048315: 60%
Entrez Gene ID: 5610
Uniprot ID: P19525
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVD |
| Documents & Links for Anti EIF2AK2 pAb (ATL-HPA063893) | |
| Datasheet | Anti EIF2AK2 pAb (ATL-HPA063893) Datasheet (External Link) |
| Vendor Page | Anti EIF2AK2 pAb (ATL-HPA063893) at Atlas |
| Documents & Links for Anti EIF2AK2 pAb (ATL-HPA063893) | |
| Datasheet | Anti EIF2AK2 pAb (ATL-HPA063893) Datasheet (External Link) |
| Vendor Page | Anti EIF2AK2 pAb (ATL-HPA063893) |