Protein Description: EH-domain containing 1
Gene Name: EHD1
Alternative Gene Name: FLJ42622, FLJ44618, H-PAST, HPAST1, PAST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107039: 71%, ENSRNOG00000043503: 71%
Entrez Gene ID: 10938
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EHD1
Alternative Gene Name: FLJ42622, FLJ44618, H-PAST, HPAST1, PAST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107039: 71%, ENSRNOG00000043503: 71%
Entrez Gene ID: 10938
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MEQPGTAASPVSGSMFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLP |
Documents & Links for Anti EHD1 pAb (ATL-HPA067747 w/enhanced validation) | |
Datasheet | Anti EHD1 pAb (ATL-HPA067747 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti EHD1 pAb (ATL-HPA067747 w/enhanced validation) at Atlas |
Documents & Links for Anti EHD1 pAb (ATL-HPA067747 w/enhanced validation) | |
Datasheet | Anti EHD1 pAb (ATL-HPA067747 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti EHD1 pAb (ATL-HPA067747 w/enhanced validation) |